PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A02G0665
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 340aa    MW: 37884.4 Da    PI: 8.3062
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A02G0665genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.19.4e-09172230563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r   NR +A rs +RK  ++ eLe+kv++L++e + L  ++ +l+     l++e+
  Gh_A02G0665 172 KRAKRILANRQSAARSKERKIRYTNELEKKVQTLQTEATNLSAQVTMLQRDTTGLTTEN 230
                  9********************************************99998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-15168232IPR004827Basic-leucine zipper domain
PfamPF077167.5E-8170221IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.024170233IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.7E-11172224No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-10172226No hitNo description
CDDcd147033.87E-23173222No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEQKLRMEID QMPPRGAHHR RAHSDTTFRF DDLLLFDPSD LDLSCLDLPD SSSNPSLPPV  60
APVPAESSDD SSCNGPPRST LNNPRHIRSL SVDSDFFDGL GLTGPAISGG AGDEKFGGKR  120
GAGEKRVHHR HSNSMDGSTT ASFDVESLMA VDGVKKTMAP DRLAELALID PKRAKRILAN  180
RQSAARSKER KIRYTNELEK KVQTLQTEAT NLSAQVTMLQ RDTTGLTTEN KELKLRLQAM  240
EQQAQLRDAL NEKLKEEVQR LRIQAGQVSA MNGNPFNRGL SPQYLTHQPA PHHFGVLQTP  300
HQQQQQQQQQ QQLQMPHSST NNPTLNGQPQ PHFMDFNQRA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.95690.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5272191e-162HQ527219.1 Gossypium herbaceum clone NBRI_B_2579 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019465.11e-177VIRE2-interacting protein 1, putative
SwissprotQ9MA751e-94VIP1_ARATH; Transcription factor VIP1
TrEMBLA0A061FHA91e-177A0A061FHA9_THECC; VIRE2-interacting protein 1, putative
STRINGVIT_18s0076g00330.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79932639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.11e-80VIRE2-interacting protein 1